SCOPe 2.07: Domain d5zlib1: 5zli B:7-110

Lineage for d5zlib1 (5zli B:7-110)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (5 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries)

8. Domain d5zlib1: 5zli B:7-110 [356976]
   Other proteins in same PDB: d5zlia2, d5zlib2, d5zlic2, d5zlid2, d5zlie2, d5zlif2
   automated match to d1htoa1

Details for d5zlib1

PDB Entry: 5zli, 2.8 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori

PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d5zlib1:

Sequence; same for both SEQRES and ATOM records:

>d5zlib1 d.15.9.0 (B:7-110) automated matches {Helicobacter pylori [TaxId: 85962]}
nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy

Timeline for d5zlib1:

• d5zlib1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30