Lineage for d5zlid1 (5zli D:7-110)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934813Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2934938Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2934939Protein automated matches [226862] (5 species)
    not a true protein
  7. 2935008Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries)
  8. 2935012Domain d5zlid1: 5zli D:7-110 [356974]
    Other proteins in same PDB: d5zlia2, d5zlib2, d5zlic2, d5zlid2, d5zlie2, d5zlif2
    automated match to d1htoa1

Details for d5zlid1

PDB Entry: 5zli (more details), 2.8 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori
PDB Compounds: (D:) glutamine synthetase

SCOPe Domain Sequences for d5zlid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlid1 d.15.9.0 (D:7-110) automated matches {Helicobacter pylori [TaxId: 85962]}
nseskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkg
wqgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy

SCOPe Domain Coordinates for d5zlid1:

Click to download the PDB-style file with coordinates for d5zlid1.
(The format of our PDB-style files is described here.)

Timeline for d5zlid1: