SCOPe 2.08: Domain d5zlie2: 5zli E:111-481

Lineage for d5zlie2 (5zli E:111-481)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:85962] [356903] (2 PDB entries)

8. Domain d5zlie2: 5zli E:111-481 [356973]
   Other proteins in same PDB: d5zlia1, d5zlib1, d5zlic1, d5zlid1, d5zlie1, d5zlif1
   automated match to d1htoa2

Details for d5zlie2

PDB Entry: 5zli, 2.8 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori

PDB Compounds: (E:) glutamine synthetase

SCOPe Domain Sequences for d5zlie2:

Sequence; same for both SEQRES and ATOM records:

>d5zlie2 d.128.1.0 (E:111-481) automated matches {Helicobacter pylori [TaxId: 85962]}
ekcprsiakkalqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnr
drsfengvnfghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqge
vgvkfgdlveaadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnen
lfsgetykglsefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrs
asvripygisknsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfklt
ldeirekgikqmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskp
hpfefittysc

Timeline for d5zlie2:

• d5zlie2 first appeared in SCOPe 2.07