Lineage for d6efgd3 (6efg D:361-559)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446486Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2446487Protein automated matches [227126] (21 species)
    not a true protein
  7. 3056660Species Kluyveromyces lactis [TaxId:284590] [356722] (2 PDB entries)
  8. 3056890Domain d6efgd3: 6efg D:361-559 [356952]
    Other proteins in same PDB: d6efga2, d6efgb2, d6efgd2, d6efge2
    automated match to d2g1ia3
    complexed with mg, tpp

Details for d6efgd3

PDB Entry: 6efg (more details), 2.04 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis
PDB Compounds: (D:) pyruvate decarboxylase

SCOPe Domain Sequences for d6efgd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6efgd3 c.36.1.0 (D:361-559) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
ptmdapsnlvkqaqltaat

SCOPe Domain Coordinates for d6efgd3:

Click to download the PDB-style file with coordinates for d6efgd3.
(The format of our PDB-style files is described here.)

Timeline for d6efgd3:

  • d6efgd3 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30