Lineage for d5olda_ (5old A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498373Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2498374Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2498375Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2498503Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 2498504Species Cow (Bos taurus) [TaxId:9913] [54079] (201 PDB entries)
  8. 3056880Domain d5olda_: 5old A: [356942]
    automated match to d1kf3a_
    complexed with dms, pt

Details for d5olda_

PDB Entry: 5old (more details), 1.78 Å

PDB Description: x-ray structure of the adduct formed upon reaction of ribonuclease a with a tetranuclear pt-thiosemicarbazone compound
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d5olda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5olda_ d.5.1.1 (A:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d5olda_:

Click to download the PDB-style file with coordinates for d5olda_.
(The format of our PDB-style files is described here.)

Timeline for d5olda_:

  • d5olda_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30