Lineage for d5zlic1 (5zli C:8-110)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2504004Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 2504129Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 2504130Protein automated matches [226862] (5 species)
    not a true protein
  7. 3056839Species Helicobacter pylori [TaxId:85962] [356901] (2 PDB entries)
  8. 3056878Domain d5zlic1: 5zli C:8-110 [356940]
    Other proteins in same PDB: d5zlia2, d5zlib2, d5zlic2, d5zlid2, d5zlie2, d5zlif2
    automated match to d1htoa1

Details for d5zlic1

PDB Entry: 5zli (more details), 2.8 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d5zlic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlic1 d.15.9.0 (C:8-110) automated matches {Helicobacter pylori [TaxId: 85962]}
seskikeffefckenevefvdfrfsdikgtwnhiaysfgalthgmlkegipfdascfkgw
qgiehsdmiltpdlvryfidpfsadvsvvvfcdvydvyknqpy

SCOPe Domain Coordinates for d5zlic1:

Click to download the PDB-style file with coordinates for d5zlic1.
(The format of our PDB-style files is described here.)

Timeline for d5zlic1:

  • d5zlic1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30