Lineage for d5opdb2 (5opd B:206-297)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2385975Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2386349Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2386350Protein automated matches [226946] (27 species)
    not a true protein
  7. 2386398Species Escherichia coli [TaxId:331112] [343071] (2 PDB entries)
  8. 3056869Domain d5opdb2: 5opd B:206-297 [356931]
    Other proteins in same PDB: d5opda1, d5opda3, d5opdb1, d5opdb3
    automated match to d1efca1
    complexed with gol, gtp, iod, mg, na

Details for d5opdb2

PDB Entry: 5opd (more details), 2.75 Å

PDB Description: structure of phosphorylated ef-tu in complex with gtp
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d5opdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5opdb2 b.43.3.0 (B:206-297) automated matches {Escherichia coli [TaxId: 331112]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d5opdb2:

Click to download the PDB-style file with coordinates for d5opdb2.
(The format of our PDB-style files is described here.)

Timeline for d5opdb2:

  • d5opdb2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30