Lineage for d5opdb1 (5opd B:7-205)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448880Protein automated matches [190047] (29 species)
    not a true protein
  7. 2448945Species Escherichia coli [TaxId:331112] [343069] (2 PDB entries)
  8. 3056868Domain d5opdb1: 5opd B:7-205 [356930]
    Other proteins in same PDB: d5opda2, d5opda3, d5opdb2, d5opdb3
    automated match to d1d8ta3
    complexed with gol, gtp, iod, mg, na

Details for d5opdb1

PDB Entry: 5opd (more details), 2.75 Å

PDB Description: structure of phosphorylated ef-tu in complex with gtp
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d5opdb1:

Sequence, based on SEQRES records: (download)

>d5opdb1 c.37.1.8 (B:7-205) automated matches {Escherichia coli [TaxId: 331112]}
ertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitints
hveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqv
gvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaewe
akilelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d5opdb1 c.37.1.8 (B:7-205) automated matches {Escherichia coli [TaxId: 331112]}
ertkvnvgtighvdhgkttltaaittvlaktyggaarfdqidnapeitintshveydtpt
rhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivf
lnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelag
fldsyipeper

SCOPe Domain Coordinates for d5opdb1:

Click to download the PDB-style file with coordinates for d5opdb1.
(The format of our PDB-style files is described here.)

Timeline for d5opdb1:

  • d5opdb1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30