Lineage for d5zlif2 (5zli F:111-481)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538589Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2538590Protein automated matches [227028] (6 species)
    not a true protein
  7. 3056841Species Helicobacter pylori [TaxId:85962] [356903] (2 PDB entries)
  8. 3056866Domain d5zlif2: 5zli F:111-481 [356928]
    Other proteins in same PDB: d5zlia1, d5zlib1, d5zlic1, d5zlid1, d5zlie1, d5zlif1
    automated match to d1htoa2

Details for d5zlif2

PDB Entry: 5zli (more details), 2.8 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori
PDB Compounds: (F:) glutamine synthetase

SCOPe Domain Sequences for d5zlif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlif2 d.128.1.0 (F:111-481) automated matches {Helicobacter pylori [TaxId: 85962]}
ekcprsiakkalqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnr
drsfengvnfghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqge
vgvkfgdlveaadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnen
lfsgetykglsefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrs
asvripygisknsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfklt
ldeirekgikqmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskp
hpfefittysc

SCOPe Domain Coordinates for d5zlif2:

Click to download the PDB-style file with coordinates for d5zlif2.
(The format of our PDB-style files is described here.)

Timeline for d5zlif2:

  • d5zlif2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30