Lineage for d6fipa1 (6fip A:247-342)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563464Fold d.212: TolA/TonB C-terminal domain [74652] (1 superfamily)
    beta(2)-alpha-beta; 2 layers, alpha/beta; left-handed beta-alpha-beta unit in non-swapped monomer
  4. 2563465Superfamily d.212.1: TolA/TonB C-terminal domain [74653] (3 families) (S)
  5. 3056857Family d.212.1.0: automated matches [356919] (1 protein)
    not a true family
  6. 3056858Protein automated matches [356920] (1 species)
    not a true protein
  7. 3056859Species Pseudomonas aeruginosa [TaxId:287] [356921] (1 PDB entry)
  8. 3056860Domain d6fipa1: 6fip A:247-342 [356922]
    Other proteins in same PDB: d6fipa2
    automated match to d1xx3a_

Details for d6fipa1

PDB Entry: 6fip (more details)

PDB Description: solution nmr structure of pseudomonas aeruginosa tonb ctd
PDB Compounds: (A:) Protein tonB

SCOPe Domain Sequences for d6fipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fipa1 d.212.1.0 (A:247-342) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gslndsdikplrmdppvyprmaqargiegrvkvlftitsdgriddiqvlesvpsrmfdre
vrqamakwrfeprvsggkivarqatkmfffkiekrr

SCOPe Domain Coordinates for d6fipa1:

Click to download the PDB-style file with coordinates for d6fipa1.
(The format of our PDB-style files is described here.)

Timeline for d6fipa1:

  • d6fipa1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6fipa2