Lineage for d5zlpa2 (5zlp A:111-481)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2975032Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2975033Protein automated matches [227028] (6 species)
    not a true protein
  7. 2975095Species Helicobacter pylori [TaxId:85962] [356903] (2 PDB entries)
  8. 2975102Domain d5zlpa2: 5zlp A:111-481 [356917]
    Other proteins in same PDB: d5zlpa1, d5zlpb1, d5zlpc1, d5zlpd1, d5zlpe1, d5zlpf1, d5zlpg1, d5zlph1, d5zlpi1, d5zlpj1, d5zlpk1, d5zlpl1
    automated match to d1htoa2
    complexed with adp, atp, mg, p3p, ppq

Details for d5zlpa2

PDB Entry: 5zlp (more details), 2.93 Å

PDB Description: crystal structure of glutamine synthetase from helicobacter pylori
PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d5zlpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zlpa2 d.128.1.0 (A:111-481) automated matches {Helicobacter pylori [TaxId: 85962]}
ekcprsiakkalqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnr
drsfengvnfghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqge
vgvkfgdlveaadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnen
lfsgetykglsefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrs
asvripygisknsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfklt
ldeirekgikqmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskp
hpfefittysc

SCOPe Domain Coordinates for d5zlpa2:

Click to download the PDB-style file with coordinates for d5zlpa2.
(The format of our PDB-style files is described here.)

Timeline for d5zlpa2: