Lineage for d5z7ya_ (5z7y A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2476490Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2476491Protein automated matches [190543] (105 species)
    not a true protein
  7. 2477287Species Striga hermonthica [TaxId:68872] [278337] (12 PDB entries)
  8. 3056852Domain d5z7ya_: 5z7y A: [356914]
    automated match to d5cbka_
    complexed with dio, edo, mg

Details for d5z7ya_

PDB Entry: 5z7y (more details), 1.9 Å

PDB Description: crystal structure of striga hermonthica htl7 (shhtl7)
PDB Compounds: (A:) Hyposensitive to light 7

SCOPe Domain Sequences for d5z7ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z7ya_ c.69.1.0 (A:) automated matches {Striga hermonthica [TaxId: 68872]}
ssiglahnvtilgsgettvvlghgygtdqsvwkllvpylvddykvllydhmgagttnpdy
fdfdrysslegysydliaileefqvskciyvghsmssmaaavasifrpdlfhklvmispt
prlinteeyyggfeqkvmdetlrsldenfkslslgtaplllacdlesaamqeycrtlfnm
rpdiaccitrmicgldlrpylghvtvpchiiqssndimvpvavgeylrknlggpsvvevm
pteghlphlsmpevtipvvlrhirqdi

SCOPe Domain Coordinates for d5z7ya_:

Click to download the PDB-style file with coordinates for d5z7ya_.
(The format of our PDB-style files is described here.)

Timeline for d5z7ya_:

  • d5z7ya_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30