![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
![]() | Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
![]() | Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
![]() | Protein automated matches [227028] (6 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [356903] (2 PDB entries) |
![]() | Domain d5zlph2: 5zlp H:111-481 [356910] Other proteins in same PDB: d5zlpa1, d5zlpb1, d5zlpc1, d5zlpd1, d5zlpe1, d5zlpf1, d5zlpg1, d5zlph1, d5zlpi1, d5zlpj1, d5zlpk1, d5zlpl1 automated match to d1htoa2 complexed with adp, atp, mg, p3p, ppq |
PDB Entry: 5zlp (more details), 2.93 Å
SCOPe Domain Sequences for d5zlph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zlph2 d.128.1.0 (H:111-481) automated matches {Helicobacter pylori [TaxId: 85962]} ekcprsiakkalqhlkdsglgdvayfgaeneffifdsikikdasnsqyyevdseegewnr drsfengvnfghrpgkqggympvpptdtmmdirteivkvlnqvgletfvvhhevaqaqge vgvkfgdlveaadnvqklkyvvkmvahlngktatfmpkplygdngsgmhthvsvwknnen lfsgetykglsefalhflggvlrharglaaftnastnsykrlipgyeapsiltysannrs asvripygisknsarfefrfpdsssnpylafaailmagmdgvknkidpgeamdinlfklt ldeirekgikqmphtlrrsleemladkqylkesqvfseefiqayqslkfnaevfpweskp hpfefittysc
Timeline for d5zlph2: