SCOPe 2.08: Domain d1efaa2: 1efa A:61-329

Lineage for d1efaa2 (1efa A:61-329)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (11 PDB entries)

8. Domain d1efaa2: 1efa A:61-329 [35691]
   Other proteins in same PDB: d1efaa1, d1efab1, d1efac1
   protein/DNA complex; complexed with npf

Details for d1efaa2

PDB Entry: 1efa, 2.6 Å

PDB Description: crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf

PDB Compounds: (A:) lac repressor

SCOPe Domain Sequences for d1efaa2:

Sequence; same for both SEQRES and ATOM records:

>d1efaa2 c.93.1.1 (A:61-329) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveacktavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrktt

Timeline for d1efaa2:

• d1efaa2 first appeared (with stable ids) in SCOP 1.55
  
• d1efaa2 appears in SCOPe 2.07