Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins) |
Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
Species Escherichia coli [TaxId:562] [53838] (11 PDB entries) |
Domain d1tlfd_: 1tlf D: [35690] complexed with emc, ipt |
PDB Entry: 1tlf (more details), 2.6 Å
SCOPe Domain Sequences for d1tlfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tlfd_ c.93.1.1 (D:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl
Timeline for d1tlfd_: