Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) |
Family d.17.2.0: automated matches [356734] (1 protein) not a true family |
Protein automated matches [356735] (2 species) not a true protein |
Species Escherichia coli [TaxId:83333] [356736] (1 PDB entry) |
Domain d6ezza3: 6ezz A:186-300 [356883] Other proteins in same PDB: d6ezza1, d6ezza4, d6ezzb1, d6ezzb4 automated match to d1oaca3 complexed with ca, cu, gol; mutant |
PDB Entry: 6ezz (more details), 1.8 Å
SCOPe Domain Sequences for d6ezza3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ezza3 d.17.2.0 (A:186-300) automated matches {Escherichia coli [TaxId: 83333]} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d6ezza3:
View in 3D Domains from other chains: (mouse over for more information) d6ezzb1, d6ezzb2, d6ezzb3, d6ezzb4 |