SCOP 1.73: Domain d1tlfb_: 1tlf B:

Lineage for d1tlfb_ (1tlf B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species)

7. Species Escherichia coli [TaxId:562] [53838] (10 PDB entries)

8. Domain d1tlfb_: 1tlf B: [35688]

Details for d1tlfb_

PDB Entry: 1tlf, 2.6 Å

PDB Description: unprecedented quaternary structure of e. coli lac repressor core tetramer: implications for dna looping

PDB Compounds: (B:) lac repressor

SCOP Domain Sequences for d1tlfb_:

Sequence; same for both SEQRES and ATOM records:

>d1tlfb_ c.93.1.1 (B:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]}
slligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvs
gliinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghq
qiallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpt
amlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqts
vdrllqlsqgqavkgnqllpvslvkrkttlapntqtaspraladslmqlarqvsrl

Timeline for d1tlfb_:

• d1tlfb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tlfb_ appears in SCOP 1.71
  
• d1tlfb_ appears in SCOP 1.75
  
• d1tlfb_ appears in the current release, SCOPe 2.08