Lineage for d5y97c1 (5y97 C:1-133)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385504Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2385505Protein automated matches [226913] (9 species)
    not a true protein
  7. 2385607Species Trichosanthes anguina [TaxId:50544] [226741] (3 PDB entries)
  8. 3056813Domain d5y97c1: 5y97 C:1-133 [356875]
    automated match to d4hr6c1
    complexed with lat, nag

Details for d5y97c1

PDB Entry: 5y97 (more details), 3.05 Å

PDB Description: crystal structure of snake gourd seed lectin in complex with lactose
PDB Compounds: (C:) seed lectin

SCOPe Domain Sequences for d5y97c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y97c1 b.42.2.0 (C:1-133) automated matches {Trichosanthes anguina [TaxId: 50544]}
neclvetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
ntysasqgwrvgn

SCOPe Domain Coordinates for d5y97c1:

Click to download the PDB-style file with coordinates for d5y97c1.
(The format of our PDB-style files is described here.)

Timeline for d5y97c1:

  • d5y97c1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30