Lineage for d5y7zc1 (5y7z C:6-122)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357712Species Llama (Lama glama) [TaxId:9844] [189241] (14 PDB entries)
  8. 3056805Domain d5y7zc1: 5y7z C:6-122 [356867]
    Other proteins in same PDB: d5y7zc2, d5y7zd2
    automated match to d1oaui_
    complexed with ire, so4

Details for d5y7zc1

PDB Entry: 5y7z (more details), 2.8 Å

PDB Description: complex structure of cyclin g-associated kinase with gefitinib
PDB Compounds: (C:) Nanobody

SCOPe Domain Sequences for d5y7zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y7zc1 b.1.1.0 (C:6-122) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqpggslrlscsasgfkfndsymswvrrvpgkglewvagiwedssaahyrdsvk
grftisrdnaknmlylqmsslksddtglyycvrrgysgdyrpinnpssqgtqvtvss

SCOPe Domain Coordinates for d5y7zc1:

Click to download the PDB-style file with coordinates for d5y7zc1.
(The format of our PDB-style files is described here.)

Timeline for d5y7zc1:

  • d5y7zc1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5y7zc2