Lineage for d5opda3 (5opd A:298-393)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2386873Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2386874Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2386981Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2386982Protein automated matches [254425] (17 species)
    not a true protein
  7. 2387007Species Escherichia coli [TaxId:331112] [343073] (2 PDB entries)
  8. 3056804Domain d5opda3: 5opd A:298-393 [356866]
    Other proteins in same PDB: d5opda1, d5opda2, d5opdb1, d5opdb2
    automated match to d1d8ta2
    complexed with gol, gtp, iod, mg, na

Details for d5opda3

PDB Entry: 5opd (more details), 2.75 Å

PDB Description: structure of phosphorylated ef-tu in complex with gtp
PDB Compounds: (A:) Elongation factor Tu 1

SCOPe Domain Sequences for d5opda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5opda3 b.44.1.0 (A:298-393) automated matches {Escherichia coli [TaxId: 331112]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvl

SCOPe Domain Coordinates for d5opda3:

Click to download the PDB-style file with coordinates for d5opda3.
(The format of our PDB-style files is described here.)

Timeline for d5opda3:

  • d5opda3 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30