Lineage for d6gd7a1 (6gd7 A:-4-103)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303644Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2303645Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2303646Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2303863Protein Mitochondrial cytochrome c [46642] (7 species)
  7. 2303867Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (78 PDB entries)
    Uniprot P00044
  8. 3056800Domain d6gd7a1: 6gd7 A:-4-103 [356862]
    Other proteins in same PDB: d6gd7a2
    automated match to d5t8wa_
    complexed with evb, gol, hec

Details for d6gd7a1

PDB Entry: 6gd7 (more details), 1.55 Å

PDB Description: cytochrome c in complex with sulfonato-calix[8]arene, h3 form with peg
PDB Compounds: (A:) Cytochrome c iso-1

SCOPe Domain Sequences for d6gd7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gd7a1 a.3.1.1 (A:-4-103) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn
vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate

SCOPe Domain Coordinates for d6gd7a1:

Click to download the PDB-style file with coordinates for d6gd7a1.
(The format of our PDB-style files is described here.)

Timeline for d6gd7a1:

  • d6gd7a1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6gd7a2