Lineage for d5xqza_ (5xqz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2318333Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2318334Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2318340Protein automated matches [319235] (2 species)
    not a true protein
  7. 2318341Species Human (Homo sapiens) [TaxId:9606] [333010] (5 PDB entries)
  8. 3056798Domain d5xqza_: 5xqz A: [356860]
    Other proteins in same PDB: d5xqzb2
    automated match to d1pi1a_
    complexed with gol, zn

Details for d5xqza_

PDB Entry: 5xqz (more details), 2.1 Å

PDB Description: structure of the mob1-ndr2 complex
PDB Compounds: (A:) MOB kinase activator 1A

SCOPe Domain Sequences for d5xqza_:

Sequence, based on SEQRES records: (download)

>d5xqza_ a.29.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
yeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktil
krlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg

Sequence, based on observed residues (ATOM records): (download)

>d5xqza_ a.29.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
yeyhwadnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktilkr
lfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg

SCOPe Domain Coordinates for d5xqza_:

Click to download the PDB-style file with coordinates for d5xqza_.
(The format of our PDB-style files is described here.)

Timeline for d5xqza_:

  • d5xqza_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30