SCOP 1.73: Domain d2pufa2: 2puf A:59-340

Lineage for d2pufa2 (2puf A:59-340)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)

8. Domain d2pufa2: 2puf A:59-340 [35686]
   Other proteins in same PDB: d2pufa1
   protein/DNA complex; complexed with gun; mutant

Details for d2pufa2

PDB Entry: 2puf, 3 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices

PDB Compounds: (A:) protein (purine repressor)

SCOP Domain Sequences for d2pufa2:

Sequence; same for both SEQRES and ATOM records:

>d2pufa2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgpleqntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

Timeline for d2pufa2:

• d2pufa2 first appeared (with stable ids) in SCOP 1.55
  
• d2pufa2 appears in SCOP 1.71
  
• d2pufa2 appears in SCOP 1.75
  
• d2pufa2 appears in the current release, SCOPe 2.08