Lineage for d5xqzb1 (5xqz B:33-216)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2318333Superfamily a.29.7: Mob1/phocein [101152] (2 families) (S)
    common fold is elaborated with additional short helices; contains a zinc-binding site
    automatically mapped to Pfam PF03637
  5. 2318334Family a.29.7.1: Mob1/phocein [101153] (2 proteins)
  6. 2318340Protein automated matches [319235] (2 species)
    not a true protein
  7. 2318341Species Human (Homo sapiens) [TaxId:9606] [333010] (5 PDB entries)
  8. 3056792Domain d5xqzb1: 5xqz B:33-216 [356854]
    Other proteins in same PDB: d5xqzb2
    automated match to d1pi1a_
    complexed with gol, zn

Details for d5xqzb1

PDB Entry: 5xqz (more details), 2.1 Å

PDB Description: structure of the mob1-ndr2 complex
PDB Compounds: (B:) MOB kinase activator 1A

SCOPe Domain Sequences for d5xqzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xqzb1 a.29.7.1 (B:33-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eatlgsgnlrqavmlpegedlnewiavntvdffnqinmlygtitefcteascpvmsagpr
yeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktil
krlfrvyahiyhqhfdsvmqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklg
skdr

SCOPe Domain Coordinates for d5xqzb1:

Click to download the PDB-style file with coordinates for d5xqzb1.
(The format of our PDB-style files is described here.)

Timeline for d5xqzb1:

  • d5xqzb1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d5xqzb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5xqza_