Lineage for d6hfya_ (6hfy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2807608Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2807621Protein Influenza neuraminidase [50943] (9 species)
  7. 2807655Species Influenza a virus (strain a/duck/england/1/1956 h11n6) [TaxId:383550] [356823] (3 PDB entries)
  8. 2807660Domain d6hfya_: 6hfy A: [356850]
    automated match to d1v0za_
    complexed with ca, dan, gol, nag

Details for d6hfya_

PDB Entry: 6hfy (more details), 1.65 Å

PDB Description: influenza a virus n6 neuraminidase complex with dana (duck/england/56).
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d6hfya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hfya_ b.68.1.1 (A:) Influenza neuraminidase {Influenza a virus (strain a/duck/england/1/1956 h11n6) [TaxId: 383550]}
rtflnltkplcevnswhilskdnairigedahilvtrepylscdpqgcrmfalsqgttlr
grhangtihdrspfraliswemgqapspyntrvecigwsstschdgmsrmsicmsgpnnn
asavvwyggrpiteipswagnilrtqesecvchkgvcpvvmtdgpannraatkiiyfkeg
kiqkieelagnaqhieecscygaggvikcicrdnwkganrpvitidpemmthtskylcsk
vltdtsrpndptngncdapitggspdpgvkgfafldgenswlgrtiskdsrsgyemlkvp
naetdiqsgpisnqvivnnqnwsgysgafidywankecfnpcfyvelirgrpkessvlwt
snsivalcgskkrlgswswhdgaeiiyfe

SCOPe Domain Coordinates for d6hfya_:

Click to download the PDB-style file with coordinates for d6hfya_.
(The format of our PDB-style files is described here.)

Timeline for d6hfya_: