Lineage for d6fqoa_ (6fqo A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316814Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2316891Protein automated matches [190366] (2 species)
    not a true protein
  7. 2316892Species Human (Homo sapiens) [TaxId:9606] [187201] (51 PDB entries)
  8. 3056785Domain d6fqoa_: 6fqo A: [356847]
    Other proteins in same PDB: d6fqob2
    automated match to d4nyxa_
    complexed with e2t, edo

Details for d6fqoa_

PDB Entry: 6fqo (more details), 1.35 Å

PDB Description: crystal structure of crebbp bromodomain complexd with dt29
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d6fqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fqoa_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

SCOPe Domain Coordinates for d6fqoa_:

Click to download the PDB-style file with coordinates for d6fqoa_.
(The format of our PDB-style files is described here.)

Timeline for d6fqoa_:

  • d6fqoa_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30