Lineage for d6gzmb_ (6gzm B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2542771Protein Casein kinase-1, CK1 [56139] (4 species)
    OPK group; CKI subfamily; serine/threonine kinase
  7. 2542777Species Human (Homo sapiens) [TaxId:9606] [224941] (16 PDB entries)
  8. 3056780Domain d6gzmb_: 6gzm B: [356842]
    automated match to d4twcb_
    complexed with cit, gol, lci

Details for d6gzmb_

PDB Entry: 6gzm (more details), 1.59 Å

PDB Description: crystal structure of human ckidelta with a86
PDB Compounds: (B:) Casein kinase I isoform delta

SCOPe Domain Sequences for d6gzmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gzmb_ d.144.1.7 (B:) Casein kinase-1, CK1 {Human (Homo sapiens) [TaxId: 9606]}
melrvgnryrlgnkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmq
ggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyih
sknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtarya
sinthlgieqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievl
ckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlkf

SCOPe Domain Coordinates for d6gzmb_:

Click to download the PDB-style file with coordinates for d6gzmb_.
(The format of our PDB-style files is described here.)

Timeline for d6gzmb_:

  • d6gzmb_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30