Lineage for d6afja_ (6afj A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2441326Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2441498Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2441499Protein DJ-1 [89603] (1 species)
    RNA-binding protein regulatory subunit
  7. 2441500Species Human (Homo sapiens) [TaxId:9606] [89604] (61 PDB entries)
    Uniprot Q99497
  8. 3056779Domain d6afja_: 6afj A: [356841]
    automated match to d1q2ua_
    complexed with 73g, cl

Details for d6afja_

PDB Entry: 6afj (more details), 1.48 Å

PDB Description: dj-1 with compound 13
PDB Compounds: (A:) Protein/nucleic acid deglycase DJ-1

SCOPe Domain Sequences for d6afja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6afja_ c.23.16.2 (A:) DJ-1 {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d6afja_:

Click to download the PDB-style file with coordinates for d6afja_.
(The format of our PDB-style files is described here.)

Timeline for d6afja_:

  • d6afja_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30