Lineage for d2puca2 (2puc A:59-340)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710422Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 710423Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 710424Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)
  6. 710572Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)
  7. 710573Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)
  8. 710582Domain d2puca2: 2puc A:59-340 [35684]
    Other proteins in same PDB: d2puca1
    protein/DNA complex; complexed with gun; mutant

Details for d2puca2

PDB Entry: 2puc (more details), 2.6 Å

PDB Description: crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices
PDB Compounds: (A:) protein (purine repressor)

SCOP Domain Sequences for d2puca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2puca2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

SCOP Domain Coordinates for d2puca2:

Click to download the PDB-style file with coordinates for d2puca2.
(The format of our PDB-style files is described here.)

Timeline for d2puca2: