Lineage for d6cd4a_ (6cd4 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316812Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2316813Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2316976Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2316977Protein automated matches [190615] (11 species)
    not a true protein
  7. 2316984Species Human (Homo sapiens) [TaxId:9606] [187641] (724 PDB entries)
  8. 3056766Domain d6cd4a_: 6cd4 A: [356828]
    automated match to d5egub_
    complexed with edo, ex1

Details for d6cd4a_

PDB Entry: 6cd4 (more details), 1.23 Å

PDB Description: crystal structure of the first bromodomain of human brd4 in complex with the inhibitor jwg046
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d6cd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cd4a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiik
tpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkin
elpt

SCOPe Domain Coordinates for d6cd4a_:

Click to download the PDB-style file with coordinates for d6cd4a_.
(The format of our PDB-style files is described here.)

Timeline for d6cd4a_:

  • d6cd4a_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30