Lineage for d5m2ec_ (5m2e C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479470Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2479471Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2479856Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2479857Protein automated matches [190603] (19 species)
    not a true protein
  7. 3056757Species Pseudomonas aeruginosa [TaxId:287] [356819] (1 PDB entry)
  8. 3056758Domain d5m2ec_: 5m2e C: [356820]
    automated match to d2iv0a_

Details for d5m2ec_

PDB Entry: 5m2e (more details), 2.7 Å

PDB Description: apo structure of pseudomonas aeruginosa isocitrate dehydrogenase, icd.
PDB Compounds: (C:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d5m2ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m2ec_ c.77.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mgyqkiqvpatgdkitvnadmslsvpknpiipfiegdgigvdispvmikvvdaavekayk
gerkiawmevyagekatqvydqdtwlpqetldavrdyvvsikgplttpvgggirslnval
rqqldlyvcqrpvrwfegvpspvkkpgdvdmvifrensediyagvewkagspeaekvikf
lteemgvkkirftencgigikpvsqegtkrlvrkalqyavdndrssvtlvhkgnimkfte
gafkdwgyevardefgaelldggpwmqfknpktgknvvvkdviadamlqqillrpaeydv
iatlnlngdylsdalaaevggigiapganlsdsvamfeathgtapkyagqdkvnpgslil
saemmlrhmgwteaadliikgtngaiaaktvtydferlmdgatllscsefgdamiakm

SCOPe Domain Coordinates for d5m2ec_:

Click to download the PDB-style file with coordinates for d5m2ec_.
(The format of our PDB-style files is described here.)

Timeline for d5m2ec_:

  • d5m2ec_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30