Lineage for d6cvkb2 (6cvk B:130-249)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2358834Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (23 PDB entries)
  8. 3056748Domain d6cvkb2: 6cvk B:130-249 [356810]
    Other proteins in same PDB: d6cvka3, d6cvkb3, d6cvkc_, d6cvkd_
    automated match to d5grul1

Details for d6cvkb2

PDB Entry: 6cvk (more details), 2.38 Å

PDB Description: hepatitis b e-antigen in complex with scfv e13
PDB Compounds: (B:) Single chain variable fragment (scFv) e13

SCOPe Domain Sequences for d6cvkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvkb2 b.1.1.0 (B:130-249) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
eqlvesggrlvppggsltltctvsgidlssnaiswvrqapgkgleyigiiyggsipyysr
wakgrftisktsttvalkmstltasdtatyfcargksdgdgyaayrldpwglgtlvtiss

SCOPe Domain Coordinates for d6cvkb2:

Click to download the PDB-style file with coordinates for d6cvkb2.
(The format of our PDB-style files is described here.)

Timeline for d6cvkb2:

  • d6cvkb2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30