Lineage for d6dr7a_ (6dr7 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2454684Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2454892Protein automated matches [190252] (4 species)
    not a true protein
  7. 3056645Species Yersinia pestis [TaxId:632] [356707] (5 PDB entries)
  8. 3056723Domain d6dr7a_: 6dr7 A: [356785]
    automated match to d1pa9a_
    complexed with act, vo4

Details for d6dr7a_

PDB Entry: 6dr7 (more details), 1.85 Å

PDB Description: yoph ptp1b wpd loop chimera 2 ptpase bound to vanadate
PDB Compounds: (A:) Targeted effector protein

SCOPe Domain Sequences for d6dr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dr7a_ c.45.1.2 (A:) automated matches {Yersinia pestis [TaxId: 632]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvttwpdfgvpesevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d6dr7a_:

Click to download the PDB-style file with coordinates for d6dr7a_.
(The format of our PDB-style files is described here.)

Timeline for d6dr7a_:

  • d6dr7a_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30