Lineage for d6asia1 (6asi A:8-227)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491927Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2491928Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2491929Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2492020Protein automated matches [257342] (3 species)
    not a true protein
  7. 3050137Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries)
  8. 3056715Domain d6asia1: 6asi A:8-227 [356777]
    Other proteins in same PDB: d6asia2, d6asia3
    automated match to d1os1a2
    complexed with 03s, atp, mg, mn; mutant

Details for d6asia1

PDB Entry: 6asi (more details), 1.79 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase g209s mutant bound to methanesulfonate
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6asia1:

Sequence, based on SEQRES records: (download)

>d6asia1 c.109.1.1 (A:8-227) automated matches {Escherichia coli [TaxId: 83333]}
tpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrsp
kdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcga
npdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglns
enfvafnltermqliggtwygsemkkgmfsmmnyllplkg

Sequence, based on observed residues (ATOM records): (download)

>d6asia1 c.109.1.1 (A:8-227) automated matches {Escherichia coli [TaxId: 83333]}
tpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrsp
kdkyivrddttrdtfwwadkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcganp
dtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqglnsen
fvafnltermqliggtwygsemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6asia1:

Click to download the PDB-style file with coordinates for d6asia1.
(The format of our PDB-style files is described here.)

Timeline for d6asia1:

  • d6asia1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30