Lineage for d6eeka_ (6eek A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381453Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2381454Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2381455Protein Staphylococcal nuclease [50201] (1 species)
  7. 2381456Species Staphylococcus aureus [TaxId:1280] [50202] (258 PDB entries)
    Uniprot P00644 89-223
  8. 3056700Domain d6eeka_: 6eek A: [356762]
    automated match to d2lkva_

Details for d6eeka_

PDB Entry: 6eek (more details), 2.2 Å

PDB Description: crystal structure of apo staphylcoccal nuclease variant delta+phs t62e/v66k, ph 7 at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d6eeka_:

Sequence, based on SEQRES records: (download)

>d6eeka_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafekkmkenakki
evefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

Sequence, based on observed residues (ATOM records): (download)

>d6eeka_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatllmykgqpmtfrlllvdtpefnekygpeasafekkmkenakkievefdkgqrt
dkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkaeaqakkeklniws

SCOPe Domain Coordinates for d6eeka_:

Click to download the PDB-style file with coordinates for d6eeka_.
(The format of our PDB-style files is described here.)

Timeline for d6eeka_:

  • d6eeka_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30