Lineage for d6dvma_ (6dvm A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873861Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2873862Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2874326Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 2874327Protein automated matches [190626] (14 species)
    not a true protein
  7. 2874462Species Zebrafish (Danio rerio) [TaxId:7955] [319911] (55 PDB entries)
  8. 2874478Domain d6dvma_: 6dvm A: [356759]
    automated match to d5g0ha_
    complexed with btb, edo, hbj, k, zn

Details for d6dvma_

PDB Entry: 6dvm (more details), 1.47 Å

PDB Description: crystal structure of danio rerio histone deacetylase 6 catalytic domain 2 in complex with ddk-122
PDB Compounds: (A:) Hdac6 protein

SCOPe Domain Sequences for d6dvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dvma_ c.42.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
itglvydqrmmlhhnmwdshhpelpqrisrifsrheelrllsrchriparlateeelalc
hsskhisiikssehmkprdlnrlgdeynsifisnesytcallaagscfnsaqailtgqvr
navaivrppghhaekdtacgfcffntaaltaryaqsitreslrvlivdwdvhhgngtqhi
feeddsvlyislhryedgaffpnsedanydkvglgkgrgynvnipwnggkmgdpeymaaf
hhlvmpiarefapelvlvsagfdaargdplggfqvtpegyahlthqlmslaagrvliile
ggynltsisesmsmctsmllgdsppsldhltplktsatvsinnvlrahapfwsslr

SCOPe Domain Coordinates for d6dvma_:

Click to download the PDB-style file with coordinates for d6dvma_.
(The format of our PDB-style files is described here.)

Timeline for d6dvma_: