Lineage for d6at3b1 (6at3 B:7-227)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491927Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2491928Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2491929Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2492020Protein automated matches [257342] (3 species)
    not a true protein
  7. 3050137Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries)
  8. 3056695Domain d6at3b1: 6at3 B:7-227 [356757]
    Other proteins in same PDB: d6at3a2, d6at3a3, d6at3b2
    automated match to d1os1a2
    complexed with oaa, thj; mutant

Details for d6at3b1

PDB Entry: 6at3 (more details), 1.46 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase y207f mutant bound to thiosulfate and oxaloacetate
PDB Compounds: (B:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6at3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at3b1 c.109.1.1 (B:7-227) automated matches {Escherichia coli [TaxId: 83333]}
ltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgrs
pkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafcg
anpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgln
senfvafnltermqliggtwfggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6at3b1:

Click to download the PDB-style file with coordinates for d6at3b1.
(The format of our PDB-style files is described here.)

Timeline for d6at3b1:

  • d6at3b1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30