Lineage for d6cqsa_ (6cqs A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (22 species)
    not a true protein
  7. 3056685Species Sediminispirochaeta smaragdinae [TaxId:573413] [356747] (1 PDB entry)
  8. 3056686Domain d6cqsa_: 6cqs A: [356748]
    automated match to d2fhxa_
    complexed with zn

Details for d6cqsa_

PDB Entry: 6cqs (more details), 1.7 Å

PDB Description: sediminispirochaeta smaragdinae sps-1 metallo-beta-lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6cqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cqsa_ d.157.1.0 (A:) automated matches {Sediminispirochaeta smaragdinae [TaxId: 573413]}
ypvirlndelevreilpnafvithkfpwggnslvvligekyavfvdtpytpeatenvldw
inkqygnrqfieintgyhvdnlggndallhrnipiigsdktvsllrergeatrqltmgwl
egpgnekflkrhetipyvgpsqifqltegyhftvgdepievffpgethapdnivvyfper
kilfggcmlrvgngtgnradanmdtwkssverlrdfdcvavipghgirfdpgvientisv
lp

SCOPe Domain Coordinates for d6cqsa_:

Click to download the PDB-style file with coordinates for d6cqsa_.
(The format of our PDB-style files is described here.)

Timeline for d6cqsa_:

  • d6cqsa_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30