SCOPe 2.08: Domain d6efha3: 6efh A:361-558

Lineage for d6efha3 (6efh A:361-558)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Kluyveromyces lactis [TaxId:284590] [356722] (2 PDB entries)

8. Domain d6efha3: 6efh A:361-558 [356745]
   Other proteins in same PDB: d6efha2, d6efhb2
   automated match to d2g1ia3
   complexed with 1pe, mg, py0, tpp

Details for d6efha3

PDB Entry: 6efh, 2.99 Å

PDB Description: pyruvate decarboxylase from kluyveromyces lactis soaked with pyruvamide

PDB Compounds: (A:) pyruvate decarboxylase

SCOPe Domain Sequences for d6efha3:

Sequence; same for both SEQRES and ATOM records:

>d6efha3 c.36.1.0 (A:361-558) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dstplkqewvwtqvgeflregdvvitetgtsafginqthfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytierli
hgetaqynciqnwqhlellptfgakdyeavrvsttgewnklttdekfqdntrirlievml
ptmdapsnlvkqaqltaa

Timeline for d6efha3:

• d6efha3 first appeared in SCOPe 2.07