Lineage for d6at4a1 (6at4 A:6-227)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491927Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2491928Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2491929Family c.109.1.1: PEP carboxykinase N-terminal domain [68924] (3 proteins)
  6. 2492020Protein automated matches [257342] (3 species)
    not a true protein
  7. 3050137Species Escherichia coli [TaxId:83333] [350199] (7 PDB entries)
  8. 3056650Domain d6at4a1: 6at4 A:6-227 [356712]
    Other proteins in same PDB: d6at4a2, d6at4b2
    automated match to d1os1a2
    complexed with thj

Details for d6at4a1

PDB Entry: 6at4 (more details), 1.33 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase bound to thiosulfate
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6at4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6at4a1 c.109.1.1 (A:6-227) automated matches {Escherichia coli [TaxId: 83333]}
gltpqeleaygisdvhdivynpsydllyqeeldpsltgyergvltnlgavavdtgiftgr
spkdkyivrddttrdtfwwadkgkgkndnkplspetwqhlkglvtrqlsgkrlfvvdafc
ganpdtrlsvrfitevawqahfvknmfirpsdeelagfkpdfivmngakctnpqwkeqgl
nsenfvafnltermqliggtwyggemkkgmfsmmnyllplkg

SCOPe Domain Coordinates for d6at4a1:

Click to download the PDB-style file with coordinates for d6at4a1.
(The format of our PDB-style files is described here.)

Timeline for d6at4a1:

  • d6at4a1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6at4a2