Lineage for d6ckxb2 (6ckx B:158-259)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2326510Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2326511Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2326512Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2326968Protein automated matches [227027] (3 species)
    not a true protein
  7. 2326982Species Human (Homo sapiens) [TaxId:9606] [225840] (13 PDB entries)
  8. 3056643Domain d6ckxb2: 6ckx B:158-259 [356705]
    automated match to d2i53a2
    complexed with 8m1, mg

Details for d6ckxb2

PDB Entry: 6ckx (more details), 2.8 Å

PDB Description: structure of cdk12/cyck in complex with a small molecule inhibitor n- (4-(1-methyl-1h-pyrazol-4-yl)phenyl)-n-((1r,4r)-4-(quinazolin-2- ylamino)cyclohexyl)acetamide
PDB Compounds: (B:) cyclin-k

SCOPe Domain Sequences for d6ckxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ckxb2 a.74.1.1 (B:158-259) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqwepeiiavavmylagrl
ckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys

SCOPe Domain Coordinates for d6ckxb2:

Click to download the PDB-style file with coordinates for d6ckxb2.
(The format of our PDB-style files is described here.)

Timeline for d6ckxb2:

  • d6ckxb2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30

View in 3D
Domains from same chain:
(mouse over for more information)
d6ckxb1