SCOP 1.55: Domain d1weta2: 1wet A:59-340

Lineage for d1weta2 (1wet A:59-340)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (12 proteins)

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (20 PDB entries)

8. Domain d1weta2: 1wet A:59-340 [35670]
   Other proteins in same PDB: d1weta1

Details for d1weta2

PDB Entry: 1wet, 2.6 Å

PDB Description: structure of the purr-guanine-purf operator complex

PDB Compounds: (A:) protein (purine repressor)

SCOP Domain Sequences for d1weta2:

Sequence; same for both SEQRES and ATOM records:

>d1weta2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

Timeline for d1weta2:

• d1weta2 appears in SCOP 1.57
  
• d1weta2 appears in the current release, SCOPe 2.08