Lineage for d6cvkd_ (6cvk D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716878Fold a.62: Hepatitis B viral capsid (hbcag) [47851] (1 superfamily)
    5 helices; array; two long helices form a hairpin that dimerizes into a 4-helical bundle
  4. 2716879Superfamily a.62.1: Hepatitis B viral capsid (hbcag) [47852] (2 families) (S)
    automatically mapped to Pfam PF00906
  5. 2716880Family a.62.1.1: Hepatitis B viral capsid (hbcag) [47853] (2 proteins)
  6. 2716887Protein automated matches [191131] (3 species)
    not a true protein
  7. 2716914Species Hepatitis B virus [TaxId:10407] [256206] (9 PDB entries)
  8. 2716938Domain d6cvkd_: 6cvk D: [356692]
    Other proteins in same PDB: d6cvka1, d6cvka2, d6cvka3, d6cvkb1, d6cvkb2, d6cvkb3
    automated match to d4bmga_

Details for d6cvkd_

PDB Entry: 6cvk (more details), 2.38 Å

PDB Description: hepatitis b e-antigen in complex with scfv e13
PDB Compounds: (D:) capsid protein

SCOPe Domain Sequences for d6cvkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cvkd_ a.62.1.1 (D:) automated matches {Hepatitis B virus [TaxId: 10407]}
sklclgwlwgmdidpykefgatvellsflpsdffpsvrdlldtaaalyrdalespehasp
hhtalrqailcwgdlmtlatwvgtnledpasrdlvvsyvntnvglkfrqllwfhisaltf
gretvleylvsfgvwirtppayrppnapilstlpe

SCOPe Domain Coordinates for d6cvkd_:

Click to download the PDB-style file with coordinates for d6cvkd_.
(The format of our PDB-style files is described here.)

Timeline for d6cvkd_: