SCOP 1.71: Domain d1bdia2: 1bdi A:59-340

Lineage for d1bdia2 (1bdi A:59-340)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (1 family)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (15 proteins)

6. Protein Purine repressor (PurR), C-terminal domain [53835] (1 species)

7. Species Escherichia coli [TaxId:562] [53836] (24 PDB entries)

8. Domain d1bdia2: 1bdi A:59-340 [35669]
   Other proteins in same PDB: d1bdia1
   protein/DNA complex; complexed with hpa

Details for d1bdia2

PDB Entry: 1bdi, 3 Å

PDB Description: purine repressor mutant-hypoxanthine-palindromic operator complex

SCOP Domain Sequences for d1bdia2:

Sequence; same for both SEQRES and ATOM records:

>d1bdia2 c.93.1.1 (A:59-340) Purine repressor (PurR), C-terminal domain {Escherichia coli}
tksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdg
llvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagryliergh
reigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqph
rptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslg
etafnmlldrivnkreepqsievhprlierrsvadgpfrdyr

Timeline for d1bdia2:

• d1bdia2 first appeared (with stable ids) in SCOP 1.55
  
• d1bdia2 appears in SCOP 1.69
  
• d1bdia2 appears in SCOP 1.73
  
• d1bdia2 appears in the current release, SCOPe 2.08