Lineage for d6asma2 (6asm A:228-540)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484523Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2484524Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2484525Family c.91.1.1: PEP carboxykinase C-terminal domain [53796] (3 proteins)
  6. 2484616Protein automated matches [257345] (3 species)
    not a true protein
  7. 3050139Species Escherichia coli [TaxId:83333] [350201] (7 PDB entries)
  8. 3056618Domain d6asma2: 6asm A:228-540 [356680]
    Other proteins in same PDB: d6asma1, d6asma3
    automated match to d2olra1
    complexed with atp, btb, mg, mn, thj, xe; mutant

Details for d6asma2

PDB Entry: 6asm (more details), 1.55 Å

PDB Description: e. coli phosphoenolpyruvate carboxykinase g209s k212c mutant bound to thiosulfate
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase (ATP)

SCOPe Domain Sequences for d6asma2:

Sequence, based on SEQRES records: (download)

>d6asma2 c.91.1.1 (A:228-540) automated matches {Escherichia coli [TaxId: 83333]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftaklagtergiteptptfsa
cfgaaflslhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsl
dnaetftlpmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdt
pagaalvaagpkl

Sequence, based on observed residues (ATOM records): (download)

>d6asma2 c.91.1.1 (A:228-540) automated matches {Escherichia coli [TaxId: 83333]}
iasmhcsanvgekgdvavffglsgtgkttlstdpkrrligddehgwdddgvfnfeggcya
ktiklskeaepeiynairrdallenvtvredgtidfddgsktentrvsypiyhidnivkp
vskaghatkvifltadafgvlppvsrltadqtqyhflsgftakleptptfsacfgaafls
lhptqyaevlvkrmqaagaqaylvntgwngtgkrisikdtraiidailngsldnaetftl
pmfnlaiptelpgvdtkildprntyaspeqwqekaetlaklfidnfdkytdtpagaalva
agpkl

SCOPe Domain Coordinates for d6asma2:

Click to download the PDB-style file with coordinates for d6asma2.
(The format of our PDB-style files is described here.)

Timeline for d6asma2:

  • d6asma2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30