Lineage for d6b3va2 (6b3v A:157-369)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462168Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2462169Protein automated matches [226839] (54 species)
    not a true protein
  7. 2462308Species Human (Homo sapiens) [TaxId:9606] [224896] (59 PDB entries)
  8. 3056615Domain d6b3va2: 6b3v A:157-369 [356677]
    Other proteins in same PDB: d6b3va3
    automated match to d5e26a2
    complexed with 7dq, anp, edo, mg

Details for d6b3va2

PDB Entry: 6b3v (more details), 1.6 Å

PDB Description: pank3 complex with compound pz-2891
PDB Compounds: (A:) Pantothenate kinase 3

SCOPe Domain Sequences for d6b3va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b3va2 c.55.1.0 (A:157-369) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qaecyyfanasepercqkmpfnlddpypllvvnigsgvsilavhskdnykrvtgtslggg
tflglcslltgcesfeealemaskgdstqadklvrdiyggdyerfglpgwavassfgnmi
ykekresvskedlaratlvtitnnigsvarmcavnekinrvvfvgnflrvntlsmkllay
aldywskgqlkalflehegyfgavgallglpnf

SCOPe Domain Coordinates for d6b3va2:

Click to download the PDB-style file with coordinates for d6b3va2.
(The format of our PDB-style files is described here.)

Timeline for d6b3va2:

  • d6b3va2 appears in periodic updates to SCOPe 2.07 starting on 2018-08-30