Lineage for d6asua_ (6asu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424043Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2424044Family c.1.13.1: Malate synthase G [51646] (2 proteins)
  6. 2424086Protein automated matches [195320] (5 species)
    not a true protein
  7. 2424093Species Mycobacterium tuberculosis [TaxId:1773] [226813] (10 PDB entries)
  8. 3056608Domain d6asua_: 6asu A: [356670]
    automated match to d2jqxa_
    complexed with bvs, mg, ni

Details for d6asua_

PDB Entry: 6asu (more details), 2.32 Å

PDB Description: crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-methyl-phenyldiketoacid
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d6asua_:

Sequence, based on SEQRES records: (download)

>d6asua_ c.1.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
avdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfeg
imdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlg
lpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkg
tmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastaw
vpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnn
cqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvras
lermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrref
karaa

Sequence, based on observed residues (ATOM records): (download)

>d6asua_ c.1.13.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrpidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlna
rfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplss
gsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilid
pesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaavl
rvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgli
aihglkadvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigim
deerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilay
edhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha
lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrw
vdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrq
nagayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraa

SCOPe Domain Coordinates for d6asua_:

Click to download the PDB-style file with coordinates for d6asua_.
(The format of our PDB-style files is described here.)

Timeline for d6asua_:

  • d6asua_ appears in periodic updates to SCOPe 2.07 starting on 2018-08-30