Lineage for d6fgqa1 (6fgq A:265-493)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (74 PDB entries)
  8. 3056598Domain d6fgqa1: 6fgq A:265-493 [356660]
    Other proteins in same PDB: d6fgqa2
    automated match to d3l0la_
    complexed with d9n

Details for d6fgqa1

PDB Entry: 6fgq (more details), 2.37 Å

PDB Description: ligand complex of rorg lbd
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6fgqa1:

Sequence, based on SEQRES records: (download)

>d6fgqa1 a.123.1.0 (A:265-493) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpiv

Sequence, based on observed residues (ATOM records): (download)

>d6fgqa1 a.123.1.0 (A:265-493) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslchverlqifqhlhpiv

SCOPe Domain Coordinates for d6fgqa1:

Click to download the PDB-style file with coordinates for d6fgqa1.
(The format of our PDB-style files is described here.)

Timeline for d6fgqa1:

  • d6fgqa1 appears in periodic updates to SCOPe 2.07 starting on 2018-08-23

View in 3D
Domains from same chain:
(mouse over for more information)
d6fgqa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6fgqb_