SCOPe 2.08: Domain d6fqxa1: 6fqx A:1-175

Lineage for d6fqxa1 (6fqx A:1-175)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries)

8. Domain d6fqxa1: 6fqx A:1-175 [356635]
   Other proteins in same PDB: d6fqxa2, d6fqxb2, d6fqxc2, d6fqxd2, d6fqxe2, d6fqxf2, d6fqxg2, d6fqxh2
   automated match to d2iz1a1
   complexed with ae3, gol, peg, pge

Details for d6fqxa1

PDB Entry: 6fqx, 2.8 Å

PDB Description: plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d6fqxa1:

Sequence; same for both SEQRES and ATOM records:

>d6fqxa1 c.2.1.0 (A:1-175) automated matches {Plasmodium falciparum [TaxId: 36329]}
mcdigliglavmgqnlslnisskgfkigvynrtyerteetmkrakeenlvvygyktveel
innlkkprkvillikagpavdenisnilkhfekgdiiidggnewyinserriklckekdv
eylamgvsggeagarygcsfmpggskyaydcvkeilekcsaqvgnspcvtyigpg

Timeline for d6fqxa1:

• d6fqxa1 first appeared in SCOPe 2.07