Lineage for d1qo0a_ (1qo0 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390243Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1390244Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1390245Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)
  6. 1390250Protein Amide receptor/negative regulator of the amidase operon (AmiC) [53833] (1 species)
  7. 1390251Species Pseudomonas aeruginosa [TaxId:287] [53834] (3 PDB entries)
  8. 1390253Domain d1qo0a_: 1qo0 A: [35663]
    Other proteins in same PDB: d1qo0d_, d1qo0e_
    complexed with bmd

Details for d1qo0a_

PDB Entry: 1qo0 (more details), 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.
PDB Compounds: (A:) amic

SCOPe Domain Sequences for d1qo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]}
rpligllfsetgvtadiersqrygallaveqlnreggvggrpietlsqdpggdpdryrlc
aedfirnrgvrflvgcymshtrkavmpvveradallcyptpyegfeyspnivyggpapnq
nsaplaaylirhygervvfigsdyiypresnhvmrhlyrqhggtvleeiyiplypsdddl
qraveriyqaradvvfstvvgtgtaelyraiarrygdgrrppiaslttseaevakmesdv
aegqvvvapyfssidtpasrafvqachgffpenatitawaeaaywqtlllgraaqaagnw
rvedvqrhlydididapqgpvrverqnnhsrlssriaeidargvfqvrwqspepirpdpy
vvvhnlddwsasm

SCOPe Domain Coordinates for d1qo0a_:

Click to download the PDB-style file with coordinates for d1qo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1qo0a_: